We use cookies to make your experience better. To comply with the new e-Privacy directive, we need to ask for your consent to set the cookies. Learn more.
SKU
VP0021
Kunitz-type kappaPI-theraphotoxin-Hs1a, recombinant venom peptide
Sequence: IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA
Availability
Produced On Demand
Blue Ice / Wet Ice
Kunitz-type kappaPI-theraphotoxin-Hs1a venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Haplopelma schmidti (Chinese bird spider). Yuan et al. described the endogenous venom peptide as a potent inhibitor of serine proteases (trypsin). Besides serine protease inhibition, this peptide has also the ability to block ion channels, specifically the voltage-gated potassium channels, which are essential for regulation of several physiological processes. This peptide is also known as Huwentoxin-XI or Kunitz-type serine protease inhibitor huwentoxin-11. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.1 mg/mL concentration.
Sequence:
IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA
Sequence:
IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA
| Shipping Conditions | Blue Ice |
|---|---|
| Storage Conditions | 2 °C to 8 °C |
| Application | Drug Discovery |
| Features | Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli |
| Product Category | Venom Peptides |
| Molecular Weight | 61,72 KDa |
Kunitz-type kappaPI-theraphotoxin-Hs1a, recombinant venom peptide
| Shipping Conditions | Blue Ice |
|---|---|
| Storage Conditions | 2 °C to 8 °C |
| Application | Drug Discovery |
| Features | Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli |
| Product Category | Venom Peptides |
| Molecular Weight | 61,72 KDa |
| Shipping Conditions | Blue Ice |
|---|---|
| Storage Conditions | 2 °C to 8 °C |
| Application | Drug Discovery |
| Features | Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli |
| Product Category | Venom Peptides |
| Molecular Weight | 61,72 KDa |
MSDS
Material Safety Data Sheets
No files currently available for download
CoA
Certificate of Analysis
