We use cookies to make your experience better. To comply with the new e-Privacy directive, we need to ask for your consent to set the cookies. Learn more.
SKU
VP0016
Waglerin-4, recombinant venom peptide
Sequence: IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA
Availability
Produced On Demand
Blue Ice / Wet Ice
Waglerin-4 venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Tropidolaemus wagleri (temple pit viper). Waglerins are a group of four small peptides (waglerin-1, waglerin-2, waglerin-3 and waglerin-4) that were isolated from the venom of Temple pit viper. These small peptides are described as antagonists of the nicotinic acetylcholine receptor (nAChR) and have long been used as tools for the characterization of the nAChR. Waglerins block nAChR inhibiting the acetylcholine ligation to receptor. Several studies report that these small peptides cause paralysis and death by respiratory failure (Molles et al. , 2002). Waglerin-4 peptide was described as a selective inhibitor that blocks the epsilon form of the nAChR. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.1 mg/mL concentration.
Sequence:
IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA
Sequence:
IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 2, Number of Disulfide bonds: 1, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 27,48 KDa |
Waglerin-4, recombinant venom peptide
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 2, Number of Disulfide bonds: 1, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 27,48 KDa |
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 2, Number of Disulfide bonds: 1, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 27,48 KDa |
MSDS
Material Safety Data Sheets
No files currently available for download
CoA
Certificate of Analysis