Notification Bar Icon

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.Learn more

Learn more
SKU
VP0016

Waglerin-4, recombinant venom peptide

Storage Conditions:
2 °C to 8 °C
Sequence: IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA
Availability
Produced On Demand
Blue Ice / Wet Ice
Unit Size
50 µg
€449.00
Waglerin-4 venom peptide is a recombinant peptide purified from  Escherichia coli  that was originally isolated from the venom of  Tropidolaemus wagleri (temple pit viper). Waglerins are a group of four small peptides (waglerin-1, waglerin-2, waglerin-3 and waglerin-4) that were isolated from the venom of Temple pit viper. These small peptides are described as antagonists of the nicotinic acetylcholine receptor (nAChR) and have long been used as tools for the characterization of the nAChR. Waglerins block nAChR inhibiting the acetylcholine ligation to receptor. Several studies report that these small peptides cause paralysis and death by respiratory failure (Molles  et al. , 2002). Waglerin-4 peptide was described as a selective inhibitor that blocks the epsilon form of the nAChR. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.1 mg/mL concentration.
Sequence:
IDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 2, Number of Disulfide bonds: 1, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 27,48 KDa
Waglerin-4, recombinant venom peptide
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 2, Number of Disulfide bonds: 1, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 27,48 KDa
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 2, Number of Disulfide bonds: 1, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 27,48 KDa

MSDS

Material Safety Data Sheets
No files currently available for download

CoA

Certificate of Analysis

Please insert your lot number to get the available CoA

Manuals

 
Related Products