Notification Bar Icon

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.Learn more

Learn more
SKU
VP0003

Diapause-specific, recombinant venom peptide

Storage Conditions:
2 °C to 8 °C
Sequence: DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW
Availability
Produced On Demand
Blue Ice / Wet Ice
Unit Size
0,15 mg
€449.00
Diapause-specific venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Gastrophysa atrocyanea (leaf beetle). The endogenous diapausespecific peptide has attractive properties, such as antifungal activity, N-type voltage-gated Ca 2+ channel blocker and has high homology with amino acid sequences encoded in the insect iridescent virus. Tanaka et al. suggest that diapause-specific peptide can be utilized as a probe to analyse functional and evolutional of the life cycles of insects and iridoviruses. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.3 mg/mL concentration.
Sequence:
DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.3 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 44,7 KDa
Diapause-specific, recombinant venom peptide
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.3 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 44,7 KDa
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.3 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 44,7 KDa

MSDS

Material Safety Data Sheets

CoA

Certificate of Analysis

Please insert your lot number to get the available CoA

Manuals

 
Related Products